PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv5_106950_iwui.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 861aa    MW: 95431.6 Da    PI: 6.3192
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv5_106950_iwui.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.9e-20126181156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Bv5_106950_iwui.t1 126 KKRYHRHTARQIQEMESLFRECPHPDDKQRMKLSQELGLKPRQVKFWFQNRRTQMK 181
                         688899***********************************************998 PP

2START157.79.4e-503345682206
                         HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT CS
               START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.................dsgealrasgvvdmvlallveellddkeqWdet 75 
                         la + ++el+k+   +ep+Wv+ s  +n+++vl ++e ++                   ++ea r++++v+m++ +lv ++ld + +W e 
  Bv5_106950_iwui.t1 334 LAMSSMDELLKMCHGNEPLWVRNS--SNSMDVLNIEEYTRMfpwphhhvdplkphyndLRTEATRDKALVIMNSINLVDSFLDAN-KWVEL 421
                         677899******************..7777777777777667778889*************************************.***** PP

                         -S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEE CS
               START  76 la....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe...sssvvRaellpSg 151
                         ++    +a+t++ + sg      g lqlm+aelq+lsplvp R+  f+Ry+    ++g w+ivd  vds q+      +s++ R +++pSg
  Bv5_106950_iwui.t1 422 FPsivsRAKTIQILASGvsghanGSLQLMYAELQVLSPLVPtRETHFLRYCHHnVEEGMWAIVDFPVDSFQESLHlshHSNIPRYRRRPSG 512
                         *****************************************************99**************999877888999********** PP

                         EEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 152 iliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                         ++i++++ng+skvtwveh++  +  p h+ +++ v+s++a+gak+w+a lqrqce+
  Bv5_106950_iwui.t1 513 CIIQDMPNGYSKVTWVEHAEILEEKPiHQTFHQYVHSTMAFGAKRWLAVLQRQCER 568
                         ********************9988888***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.05E-20107184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-21119188IPR009057Homeodomain-like
PROSITE profilePS5007117.329123183IPR001356Homeobox domain
SMARTSM003893.8E-18124187IPR001356Homeobox domain
CDDcd000861.66E-18126184No hitNo description
PfamPF000461.0E-17126181IPR001356Homeobox domain
PROSITE patternPS000270158181IPR017970Homeobox, conserved site
PROSITE profilePS5084843.128324571IPR002913START domain
SuperFamilySSF559616.32E-29325570No hitNo description
CDDcd088758.36E-115328567No hitNo description
SMARTSM002343.2E-35333568IPR002913START domain
PfamPF018521.7E-42334568IPR002913START domain
SuperFamilySSF559611.32E-15586826No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 861 aa     Download sequence    Send to blast
MYGDCQVALP STMGGAAENG IQSITADCSS LFSSPLRNPN NNNNSTNVNV NVNAFTFMAS  60
LQPAFHPFAP IIPVKEERGK EEMMESMSGS ELNMEGQGGL SGNELDSLSG DPLNQNQSQP  120
SSGSKKKRYH RHTARQIQEM ESLFRECPHP DDKQRMKLSQ ELGLKPRQVK FWFQNRRTQM  180
KAQQDRTDNV ILRSENDNLK NENYRLQAVL RSLVCPGCGG GSILGEVEYD EQQLRIENSR  240
LKEELDRVCA VASRYTGRSL QTLGPSPPPA TLLPHPPSLD LDMGIYSRHF QEPMPPCTQM  300
LPMSLLPEST DFPVGGSGGG ELILDEERSL AMELAMSSMD ELLKMCHGNE PLWVRNSSNS  360
MDVLNIEEYT RMFPWPHHHV DPLKPHYNDL RTEATRDKAL VIMNSINLVD SFLDANKWVE  420
LFPSIVSRAK TIQILASGVS GHANGSLQLM YAELQVLSPL VPTRETHFLR YCHHNVEEGM  480
WAIVDFPVDS FQESLHLSHH SNIPRYRRRP SGCIIQDMPN GYSKVTWVEH AEILEEKPIH  540
QTFHQYVHST MAFGAKRWLA VLQRQCERVA SLMARNVSDL GVIQSPEARK NFMKLAQRMI  600
RTFCVNISTS GGQSWTALSD SAEDTVRITT RKIMEPGQPN GLILCAVSTT WLPYSHDQVF  660
DLLKNEYRRS QLEALSNGSS LHEVAHIANG SHPGNCISLF RINVASNSSQ NVELMLQESC  720
TDPSGSLVVY ATMEVDYIQL VMSGEDPCCI PLLPTGFSII PLGQTNTTTN ATNAEAQGQT  780
NMNHHNTGGC LLTIGIQVHA SAIPNAKLNL SSVNAINNHI CSVVHQINVA LGNIDGNNNA  840
NTNNNANNSN NASASVAPTS N
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010677365.10.0PREDICTED: homeobox-leucine zipper protein HDG5 isoform X2
RefseqXP_010677366.10.0PREDICTED: homeobox-leucine zipper protein HDG5 isoform X2
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0J8CCN10.0A0A0J8CCN1_BETVU; Uncharacterized protein
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7